FGFR3[K650Q] Protein
SKU: 25804528546

FGFR3[K650Q] Protein

Sale price$345.15 Regular price$383.50
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FGFR3[K650Q] ProteinProduct Specification Species Human Synonyms FGFR3[K650Q],FGFR3 Accession P22607 1 Amino Acid Sequence P436 T806(end)

Product Specification


Species Human
Synonyms FGFR3[K650Q],FGFR3
Accession P22607-1
Amino Acid Sequence

P436-T806(end)

PLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKQTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT

Expression System Baculovirus-InsectCells
Molecular Weight 67.8 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag GST Tag
Physical Appearance Liquid
Storage Buffer 50 mM Tris, 150 mM NaCl, 1 mM DTT, 10% glycerol, 0.05% Brij35, pH 7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 25804528546

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 300 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Lala
Omaha, US
★★★★★ 5
My Favorite Face Mask for Hydrated, Glowing Skin
Scent: Collagen, Size: 4 Count (Pack of 1)
I’ve tried a lot of face masks over the years, but the BIODANCE Bio-Collagen Real Deep Mask has easily become my favorite. Every time I use it, my skin feels incredibly hydrated, smooth, and refreshed, and the results last much longer than I expected from a single mask treatment. One of the things I love most about this mask is how deeply moisturizing it is. After wearing it overnight, my skin looks noticeably plumper and feels soft and nourished. Instead of just giving a temporary boost, I’ve found that the healthy glow lasts well beyond the next day. In my experience, my skin maintained a radiant, hydrated appearance for nearly two weeks after use, which is something I haven’t experienced with many other masks. The hydrogel material feels comfortable on the skin and stays in place well throughout the night. When I remove it in the morning, my skin looks brighter, more refreshed, and noticeably more hydrated. I appreciate that this mask feels like a true self-care treatment rather than just another skincare step. Whether I’m preparing for a special event or simply giving my skin some extra attention, this is the mask I consistently reach for. The fact that it comes in a multi-pack makes it even better because I always like having one available when my skin needs a boost. Overall, this is one of the few skincare products that I continue to repurchase because I genuinely notice a difference. If you’re looking for a mask that delivers intense hydration, plumping benefits, and a beautiful long-lasting glow, I highly recommend giving this one a try.I’m
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
E
Verified Purchase
Erin Amones
Natrona Heights, US
★★★★★ 5
Instant Glass Skin!
Scent: Collagen, Size: 4 Count (Pack of 1)
I’ve tried SO many sheet masks and this collagen one is genuinely one of the best. My skin looked insanely hydrated, smooth, and glowy after just one use. It fit my face really well, stayed soaked the entire time, and didn’t leave that sticky feeling afterward. The next morning my skin still felt soft and looked brighter. Perfect before events or whenever your skin needs a reset. Definitely repurchasing!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
A
Verified Purchase
Amy Marie Anderson
Port Orchard, US
★★★★★ 5
Absolutely amazing masks!!!
Scent: Collagen, Size: 4 Count (Pack of 1)
These masks are beyond amazing! I use one once a week and leave it on overnight after completing my p.m. skincare routine and wake up to smooth, plump, moisturized, and absolutely glowing!! I have extremely sensitive skin and eyes and these masks do not bother me at all. No burning in my eyes and no irritation of the skin. My deep wrinkles seem a lot less pronounced and some of my more fine lines almost disappear for 24 hours after using this mask. They are simple to use and adhere to the skin perfectly even after applying serums and moisturizers. Once the mask is completely absorbed and becomes clear it peels of the skin with ease. Based on the quality of these masks I am shocked by the low price, it is such a great value for your money. This Mask has become a staple in my skincare routine and I will continue to purchase these!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
T
Verified Purchase
Tara Rekatsinas
Grantham, US
★★★★★ 5
instantly more hydrated + glowy skin
Scent: Collagen, Size: 4 Count (Pack of 1), Scent: Collagen, Size: 4 Count (Pack of 1)
I love this mask. It’s one of those products you can actually see a difference with right after using it. It really helps with: 1. Deep hydration – my skin feels plump and moisturized, not dry or tight 2. Smoother texture – it softens everything and makes my skin feel really smooth 3. Glow/brightness – gives that fresh, healthy glow without looking greasy How I use it: I apply it on clean skin (usually at night), leave it on as directed, and let it fully absorb before removing. I like using it when my skin feels dull or dry and want a quick reset. Overall, it’s super easy to use and makes my skin look more refreshed every time. Definitely a go-to for me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
A
Verified Purchase
Ashley
Dallas, US
★★★★★ 4
Woke Up Glowing ✨ (But Sleeping In It Is a Stretch lol)
Scent: Collagen, Size: 4 Count (Pack of 1)
I was honestly impressed with this mask! It feels super soft, cooling, and refreshing while wearing it. The jelly texture makes it feel really hydrating and luxe, like a mini spa night at home. My skin looked smooth, plump, and GLOWING the entire next day after I took it off. Like… noticeably radiant. I also have sensitive skin, so I was a little nervous trying it at first, but I didn’t have any irritation or reaction at all. My skin felt calm, hydrated, and refreshed afterward. One thing I actually liked was that the mask was easy to customize a little. I have a nose piercing, so I just tore a small piece near my nose so it would fit comfortably without irritating it. The material held up perfectly, so that was a nice bonus for anyone with piercings or who just needs a better fit in certain areas. My only complaint is the “sleep in it” part of the instructions. I personally don’t see how that’s possible 😅 The mask stays pretty moist and jelly-like the whole time, so it felt uncomfortable to lay down in and I kept feeling like it would slide around. I ended up just wearing it for a while before bed instead. Overall though, the results were worth it and I’d definitely use it again for the glow alone!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026

recommand products